AGPAT7 Antibody

Images

 
Western Blot: AGPAT7 Antibody [NBP1-90210] - Analysis of AGPAT7 in HEK293 cells that were transfected with (left lane) non-targeting siRNA and (right lane) AGPAT7 siRNA. Image from verified customer review.
Immunohistochemistry-Paraffin: AGPAT7 Antibody [NBP1-90210] - Staining of human kidney shows strong cytoplasmic staining and nucleolar positivity in tubule cells.
Western Blot: AGPAT7 Antibody [NBP1-90210] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGPAT7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LPCAT4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGPAT7 Protein (NBP1-90210PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90210 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGPAT7 Antibody

  • acyltransferase like 3
  • Acyltransferase-like 3
  • AGPAT7acyl-CoA:lysophosphatidylethanolamine acyltransferase 2
  • AYTL3lysophospholipid acyltransferase LPCAT4,1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acidacyltransferase, eta)
  • EC 2.3.1
  • EC 2.3.1.-
  • EC 2.3.1.23
  • FLJ10257,1-acylglycerol-3-phosphate O-acyltransferase 7
  • LPAAT-eta
  • LPEAT21-AGPAT 7
  • lysophosphatidylcholine acyltransferase 41-AGP acyltransferase 7
  • Lysophosphatidylethanolamine acyltransferase 2
  • PLSC domain containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57898
Species: Hu
Applications: WB, IHC-P
NBP2-04299
Species: Hu
NBP1-82236
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88923
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-88921
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-55258
Species: Hu
Applications: WB
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for AGPAT7 Antibody (NBP1-90210) (0)

There are no publications for AGPAT7 Antibody (NBP1-90210).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for AGPAT7 Antibody (NBP1-90210) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-90210:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot AGPAT7 NBP1-90210
Enlarge
reviewed by:
Anonymous
WB Human 09/22/2015
View

Summary

ApplicationWestern Blot
Sample TestedHEK293 cells
SpeciesHuman
LotR31872

Blocking

Blocking Details1X TBST with 5% w/v nonfat dry milk for 2 hours at RT

Primary Anitbody

Dilution Ratio1:500

Secondary Antibody

Secondary DescriptionGoat Anti-Rabbit IgG Antibody, HRP-conjugate
Secondary Manufacturer Cat#12-348 Millipore
Secondary Concentration1:5000

Details

Detection NotesLuminata Crescendo Western HRP substrate for 5 min at room temperature. Expose to x-ray film for 2 min.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGPAT7 Antibody (NBP1-90210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGPAT7 Products

Bioinformatics Tool for AGPAT7 Antibody (NBP1-90210)

Discover related pathways, diseases and genes to AGPAT7 Antibody (NBP1-90210). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT7 Antibody (NBP1-90210)

Discover more about diseases related to AGPAT7 Antibody (NBP1-90210).

PTMs for AGPAT7 Antibody (NBP1-90210)

Learn more about PTMs related to AGPAT7 Antibody (NBP1-90210).
 

Research Areas for AGPAT7 Antibody (NBP1-90210)

Find related products by research area.

Blogs on AGPAT7

There are no specific blogs for AGPAT7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
09/22/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol LPCAT4
Entrez
Uniprot