AGPAT1 Antibody - BSA Free

Immunoprecipitation: AGPAT1 Antibody [NBP3-38279] - Immunoprecipitation analysis of 200 ug extracts of 293T cells, using 3 ug AGPAT1 antibody. Western blot was performed from the immunoprecipitate using AGPAT1 antibody at a dilution of 1:1000.

Western Blot: AGPAT1 Antibody [NBP3-38279] - Western blot analysis of various lysates using AGPAT1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AGPAT1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AGPAT1 Antibody - BSA Free (NBP3-38279) is a polyclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 204-283 of human AGPAT1 (NP_006402.1).
  
  Sequence:
  PIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGPAT1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AGPAT1 Antibody - BSA Free

• 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase)
• 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha)
• 1-acylglycerol-3-phosphate O-acyltransferase 1
• 1-AGP acyltransferase 1
• 1-AGPAT1
• EC 2.3.1.51
• G15
• LPAATA
• LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
• Lysophosphatidic acid acyltransferase alpha
• lysophospholipid acyltransferase
• MGC4007,1-AGPAT 1
• MGC5423
• Protein G15

Background

AGPAT1 (1-acyl-sn-glycerol-3-phosphate acyltransferase alpha) is a 283 amino acid enzyme located in the endoplasmic reticulum that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Defects in this protein have been linked to aspergillosis, systemic lupus erythematosus, meningitides, lupus erythematosus, Alzheimer's disease, gastric cancer and tuberculosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGPAT1