AGMO Antibody

Images

 
Western Blot: AGMO Antibody [NBP1-70404] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGMO Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM195 (transmembrane protein 195) The peptide sequence was selected from the middle region of TMEM195)(50ug). Peptide sequence AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGMO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM195 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for AGMO Antibody

  • alkylglycerol monooxygenase
  • transmembrane protein 195

Background

TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-87493
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-24517
Species: Hu, Rt, Bv, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-94053
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-81480
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84949
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for AGMO Antibody (NBP1-70404) (0)

There are no publications for AGMO Antibody (NBP1-70404).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGMO Antibody (NBP1-70404) (0)

There are no reviews for AGMO Antibody (NBP1-70404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGMO Antibody (NBP1-70404) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGMO Products

AGMO NBP1-70404

Bioinformatics Tool for AGMO Antibody (NBP1-70404)

Discover related pathways, diseases and genes to AGMO Antibody (NBP1-70404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGMO Antibody (NBP1-70404)

Discover more about diseases related to AGMO Antibody (NBP1-70404).

PTMs for AGMO Antibody (NBP1-70404)

Learn more about PTMs related to AGMO Antibody (NBP1-70404).

Blogs on AGMO

There are no specific blogs for AGMO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGMO Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGMO