AGMAT Antibody

Images

 
Orthogonal Strategies: Western Blot: AGMAT Antibody [NBP1-82080] - Analysis in human cell lines Caco-2 and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Western Blot: AGMAT Antibody [NBP1-82080] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human lymph node shows very weak cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining in human kidney and lymph node tissues.. Corresponding AGMAT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AGMAT Antibody [NBP1-82080] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

AGMAT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHG
Specificity
Specificity of human AGMAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGMAT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGMAT Protein (NBP1-82080PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGMAT Antibody

  • agmatinase, mitochondrial
  • agmatine ureohydrolase (agmatinase)
  • Agmatine ureohydrolase
  • AUH
  • EC 3.5.3
  • EC 3.5.3.11
  • FLJ23384

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15447
Species: Hu
Applications: WB
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP2-15447
Species: Hu
Applications: WB
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP2-62658
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82080
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AGMAT Antibody (NBP1-82080) (0)

There are no publications for AGMAT Antibody (NBP1-82080).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGMAT Antibody (NBP1-82080) (0)

There are no reviews for AGMAT Antibody (NBP1-82080). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGMAT Antibody (NBP1-82080) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AGMAT Antibody (NBP1-82080)

Discover related pathways, diseases and genes to AGMAT Antibody (NBP1-82080). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGMAT Antibody (NBP1-82080)

Discover more about diseases related to AGMAT Antibody (NBP1-82080).
 

Pathways for AGMAT Antibody (NBP1-82080)

View related products by pathway.

Research Areas for AGMAT Antibody (NBP1-82080)

Find related products by research area.

Blogs on AGMAT

There are no specific blogs for AGMAT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGMAT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGMAT
Entrez
Uniprot