We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

AFF4 Recombinant Protein Antigen

Images

 
There are currently no images for AFF4 Protein (NBP1-89220PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AFF4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AFF4.

Source: E. coli

Amino Acid Sequence: QGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKYKSTSKSSQKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AFF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89220.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AFF4 Recombinant Protein Antigen

  • AF4/FMR2 family, member 4
  • AF5Q31AF4/FMR2 family member 4
  • ALL1-fused gene from chromosome 5q31 protein
  • Major CDK9 elongation factor-associated protein
  • MCEFALL1 fused gene from 5q31
  • MGC75036
  • Protein AF-5q31

Background

AFF4, or AF4/FMR2 family member 4, contains a 127 kDa, 98 kDa, and 39 kDa isoform, and is involved in the process of improving the catalytic rate of RNA polymerase II transcription. Disease research is currently being conducted with AFF4 on its relation to acute lymphoblastic leukemia, as well as other types of leukemia. This protein interacts with SIAH1, CCNT1, MLLT3, MLLT1, and MED10 during the regulation of DNA-dependent transcription and the transcription of RNA polymerase II.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28728
Species: Hu
Applications: IHC,  IHC-P, IP (-), WB
NBP2-54913
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF
NBP2-84403
Species: Hu
Applications: WB
NBP3-15345
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-15303
Species: Hu, Mu
Applications: CHIP-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP2-13955
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
NBP1-26653
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NB100-40845
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, KD, WB
NBP3-45183
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-31637
Species: Hu
Applications: IHC,  IHC-P
NBP3-41307
Species: Bv, Hu
Applications: Flow, ICC/IF, IHC, WB
NBP1-06069
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-46605
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NB100-1972
Species: Ba, Ca, Ch, Fi, Gp, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00006827-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-61707
Species: Hu
Applications: ELISA, Flow, WB
NBP1-89220PEP
Species: Hu
Applications: AC

Publications for AFF4 Protein (NBP1-89220PEP) (0)

There are no publications for AFF4 Protein (NBP1-89220PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AFF4 Protein (NBP1-89220PEP) (0)

There are no reviews for AFF4 Protein (NBP1-89220PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AFF4 Protein (NBP1-89220PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AFF4 Products

Blogs on AFF4

There are no specific blogs for AFF4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AFF4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AFF4