Recombinant Human AFF4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AFF4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human AFF4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKSNPNFFEQRHGGSHQSSKW

Protein/Peptide Type
Partial Recombinant Protein
Gene
AFF4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AFF4 Protein

  • AF4/FMR2 family, member 4
  • AF5Q31AF4/FMR2 family member 4
  • ALL1-fused gene from chromosome 5q31 protein
  • Major CDK9 elongation factor-associated protein
  • MCEFALL1 fused gene from 5q31
  • MGC75036
  • Protein AF-5q31

Background

AFF4 - AF4/FMR2 family, member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
NB600-248
Species: Hu
Applications: WB, IP
NBP1-87714
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1566
Species: Hu
Applications: WB, IP
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP2-55603
Species: Hu
Applications: WB, ICC/IF
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00085403-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006827-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA

Publications for AFF4 Partial Recombinant Protein (H00027125-Q01) (0)

There are no publications for AFF4 Partial Recombinant Protein (H00027125-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AFF4 Partial Recombinant Protein (H00027125-Q01) (0)

There are no reviews for AFF4 Partial Recombinant Protein (H00027125-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AFF4 Partial Recombinant Protein (H00027125-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AFF4 Products

Bioinformatics Tool for AFF4 Partial Recombinant Protein (H00027125-Q01)

Discover related pathways, diseases and genes to AFF4 Partial Recombinant Protein (H00027125-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AFF4 Partial Recombinant Protein (H00027125-Q01)

Discover more about diseases related to AFF4 Partial Recombinant Protein (H00027125-Q01).
 

Pathways for AFF4 Partial Recombinant Protein (H00027125-Q01)

View related products by pathway.

PTMs for AFF4 Partial Recombinant Protein (H00027125-Q01)

Learn more about PTMs related to AFF4 Partial Recombinant Protein (H00027125-Q01).

Blogs on AFF4

There are no specific blogs for AFF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AFF4 Antibody
H00027125-D01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AFF4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AFF4