Advillin Antibody

Images

 
Western Blot: Advillin Antibody [NBP1-80312] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Advillin Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human AVIL. Peptide sequence: QELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (92%), Rat (92%), Porcine (93%), Bovine (100%), Rabbit (93%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AVIL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunocytochemistry/Immunofluorescence
Application Notes
This is a rabbit polyclonal antibody against AVIL and was validated on Western blot. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 29058690).
Theoretical MW
92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-80312 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Advillin Antibody

  • ADVIL
  • advillin
  • DOC6
  • FLJ12386
  • MGC133244
  • p92DKFZp779O1812

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5359
Species: Hu, Mu, Rt
Applications: WB, Simple Western
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
AF5758
Species: Hu
Applications: WB, IHC, ICC
NBP2-14207
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1985
Species: Hu, Mu(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF2409
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-89230
Species: Hu
Applications: WB, IHC, IHC-P
AF1916
Species: Hu
Applications: WB, IHC, ICC
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-19985
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu
H00008814-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu

Publications for Advillin Antibody (NBP1-80312)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Advillin Antibody (NBP1-80312) (0)

There are no reviews for Advillin Antibody (NBP1-80312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Advillin Antibody (NBP1-80312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Advillin Products

Bioinformatics Tool for Advillin Antibody (NBP1-80312)

Discover related pathways, diseases and genes to Advillin Antibody (NBP1-80312). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Advillin Antibody (NBP1-80312)

Discover more about diseases related to Advillin Antibody (NBP1-80312).
 

Pathways for Advillin Antibody (NBP1-80312)

View related products by pathway.

PTMs for Advillin Antibody (NBP1-80312)

Learn more about PTMs related to Advillin Antibody (NBP1-80312).
 

Research Areas for Advillin Antibody (NBP1-80312)

Find related products by research area.

Blogs on Advillin

There are no specific blogs for Advillin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Advillin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AVIL
Uniprot