We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ADRM1 Recombinant Protein Antigen

Images

 
There are currently no images for ADRM1 Protein (NBP1-88993PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADRM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADRM1.

Source: E. coli

Amino Acid Sequence: ATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADRM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88993.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADRM1 Recombinant Protein Antigen

  • 000 surface antigen
  • 110 kDa cell membrane glycoprotein
  • adhesion regulating molecule 1
  • Adhesion-regulating molecule 1
  • ADRM1
  • ARM1
  • ARM-1
  • Gp110
  • GP110hRpn13
  • M(r) 110
  • MGC29536
  • proteasomal ubiquitin receptor ADRM1
  • Proteasome regulatory particle non-ATPase 13
  • PSMD16
  • regulatory particle non-ATPase 13
  • Rpn13 homolog
  • Rpn13

Background

ADRM1 is encoded by this gene is an integral plasma membrane protein which promotes cell adhesion. The encoded protein is thought to undergo O-linked glycosylation. Expression of this gene has been shown to be induced by gamma interferon in some cancer cells. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93687
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-19952
Species: Hu
Applications: ICC/IF, KD, WB
NBP2-38323
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-80835
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-1483
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, PEP-ELISA, PLA, WB
NBP1-80961
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01294
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-67917
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-78759
Species: Hu
Applications: IP, WB
NBP1-71689
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32510
Species: Hu
Applications: ELISA, IHC,  IHC-P, KO, WB
NBP3-12954
Species: Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00001072-M04
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-25164
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KD, KO, Simple Western, WB
NBP1-88993PEP
Species: Hu
Applications: AC

Publications for ADRM1 Protein (NBP1-88993PEP) (0)

There are no publications for ADRM1 Protein (NBP1-88993PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADRM1 Protein (NBP1-88993PEP) (0)

There are no reviews for ADRM1 Protein (NBP1-88993PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADRM1 Protein (NBP1-88993PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADRM1 Products

Research Areas for ADRM1 Protein (NBP1-88993PEP)

Find related products by research area.

Blogs on ADRM1

There are no specific blogs for ADRM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADRM1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADRM1