Recombinant Human Adrenomedullin R/ADMR/GPR182 Protein Summary
| Description |
An untagged recombinant protein corresponding to the amino acid sequence of (NP_009195.1) for Human Adrenomedullin R/ADMR/GPR182 Source: Wheat Germ (in vitro) with proprietary liposome technology Amino Acid Sequence: MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVICVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVDRYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTILGFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYFFYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS |
Preparation Method |
in vitro wheat germ expression system with proprietary liposome technology |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
GPR182 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Immunoaffinity Purification
|
| Theoretical MW |
45.3 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Preservative |
Glycerol |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Adrenomedullin R/ADMR/GPR182 Protein
Background
G Protein-Coupled Receptor L1/G10D has been suggested to be an Adrenomedullin Receptor. Originally cloned from rats and later from humans, L1/G10D does not to bind adrenomedullin or display functional cAMP response to adrenomedullin (reviewed in Poyner et al. 2002). The initial experimental results, which demonstrated high-affinity binding and increased levels of cAMP in COS cells that were transfected with L1/G10D and treated with adrenomedullin, could not be reproduced by other laboratories (Kapas et al. 1995). It is now known that the functional adrenomedullin receptor is a heterodimeric complex composed of calcitonin receptor-like receptor (CRLR) and receptor activity modifying proteins (RAMPs) (McLatchie et al. 1998). L1/G10D therefore should be considered an Orphan A receptor. L1/G10D expression has been reported in adrenal gland, bone marrow, brain, heart, kidney, liver, lung, lymph node, pancreas, skeletal muscle, small intestine, spleen, stomach, testis, and thyroid. ESTs have been isolated from kidney, liver/spleen, fetal lung/testis/B-cell, and melanocyte/uterus/fetal heart libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: AP
Publications for Adrenomedullin R/ADMR/GPR182 Recombinant Protein (H00011318-G01) (0)
There are no publications for Adrenomedullin R/ADMR/GPR182 Recombinant Protein (H00011318-G01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adrenomedullin R/ADMR/GPR182 Recombinant Protein (H00011318-G01) (0)
There are no reviews for Adrenomedullin R/ADMR/GPR182 Recombinant Protein (H00011318-G01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Adrenomedullin R/ADMR/GPR182 Recombinant Protein (H00011318-G01) (0)
Additional Adrenomedullin R/ADMR/GPR182 Products
Research Areas for Adrenomedullin R/ADMR/GPR182 Recombinant Protein (H00011318-G01)
Find related products by research area.
|
Blogs on Adrenomedullin R/ADMR/GPR182