We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen

Images

 
There are currently no images for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUDT5.

Source: E. coli

Amino Acid Sequence: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NUDT5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83131.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen

  • EC 3.6.1.-
  • EC 3.6.1.13
  • hYSAH1
  • nucleoside diphosphate linked moiety X-type motif 5
  • Nucleoside diphosphate-linked moiety X motif 5
  • nudix (nucleoside diphosphate linked moiety X)-type motif 5
  • Nudix motif 5
  • NUDT5
  • YSA1
  • YSA1H
  • YSA1HADP-sugar pyrophosphatase

Background

Nudix hydrolases, such as NUDT5, eliminate toxic nucleotide derivatives from the cell and regulate the levels of important signaling nucleotides and their metabolites (McLennan, 1999 [PubMed 10373642]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-109
Species: Hu, Mu, Rt
Applications: COMET, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, KD, KO, mIF, Simple Western, Single-Cell Western, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
1585-SE
Species: Hu
Applications: EnzAct
NBP2-01072
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76879
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB110-81601
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-88835
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-87845
Species: Hu
Applications: IHC,  IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
NB600-501
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gt, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, COMET, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, mIF, Simple Western, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
DR2A00
Species: Hu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
NBP1-83131PEP
Species: Hu
Applications: AC

Publications for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP) (0)

There are no publications for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP) (0)

There are no reviews for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADP-Sugar Pyrophosphatase/NUDT5 Products

Research Areas for ADP-Sugar Pyrophosphatase/NUDT5 Protein (NBP1-83131PEP)

Find related products by research area.

Blogs on ADP-Sugar Pyrophosphatase/NUDT5

There are no specific blogs for ADP-Sugar Pyrophosphatase/NUDT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADP-Sugar Pyrophosphatase/NUDT5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT5