ADNP Antibody (6B8) - Azide and BSA Free

Western Blot: ADNP Antibody (6B8) [H00023394-M01] - Detection against Immunogen (35.09 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ADNP Antibody (6B8) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ADNP Antibody (6B8) - Azide and BSA Free (H00023394-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
• Localization: Nuclear
• Specificity: ADNP - activity-dependent neuroprotector
• Isotype: IgG3 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ADNP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADNP Antibody (6B8) - Azide and BSA Free

• Activity-dependent neuroprotective protein
• activity-dependent neuroprotector homeobox
• activity-dependent neuroprotector
• ADNP homeobox 1
• ADNP
• ADNP1
• ADNP1KIAA0784activity-dependent neuroprotector homeobox protein

Background

Vasoactive intestinal peptide is a neuroprotective factor that has a stimulatory effect on the growth of some tumor cells and an inhibitory effect on others. This gene encodes a protein that is upregulated by vasoactive intestinal peptide and may be involved in its stimulatory effect on certain tumor cells. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor. This gene is also upregulated in normal proliferative tissues. Finally, the encoded protein may increase the viability of certain cell types through modulation of p53 activity. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADNP
• Entrez:
  • 23394(Human)
• Uniprot:
  • NP_056154(Human)