ADNP Antibody (2C5) - Azide and BSA Free

Western Blot: ADNP Antibody (2C5) [H00023394-M02] - Analysis of ADNP expression in transfected 293T cell line by ADNP monoclonal antibody (M02), clone 2C5.Lane 1: ADNP transfected lysate (Predicted MW: 123.6 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: ADNP Antibody (2C5) [H00023394-M02] - Analysis of monoclonal antibody to ADNP on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: ADNP Antibody (2C5) [H00023394-M02] - Detection limit for recombinant GST tagged ADNP is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2C5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ADNP Antibody (2C5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ADNP Antibody (2C5) - Azide and BSA Free (H00023394-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ADNP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADNP Antibody (2C5) - Azide and BSA Free

• Activity-dependent neuroprotective protein
• activity-dependent neuroprotector homeobox
• activity-dependent neuroprotector
• ADNP homeobox 1
• ADNP
• ADNP1
• ADNP1KIAA0784activity-dependent neuroprotector homeobox protein

Background

The activity dependent neuroprotective protein (ADNP) gene is frequently amplified in many neoplasias, including breast, bladder, ovarian, pancreatic, and colon cancers. ADNP mRNA is abundantly expressed in distinct normal tissues, and high expression levels were encountered in malignant cells. ADNP is implicated in maintaining cell survival, perhaps through modulation of p53. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADNP
• Uniprot:
  • NP_056154(Human)