ADNP Antibody (2C5) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse ADNP Antibody (2C5) - Azide and BSA Free (H00023394-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
ADNP (NP_056154, 1018 a.a. ~ 1102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ADNP |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Sandwich ELISA
- Western Blot
|
| Application Notes |
This antibody is useful for ELISA, Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for ADNP Antibody (2C5) - Azide and BSA Free
Background
The activity dependent neuroprotective protein (ADNP) gene is frequently amplified in many neoplasias, including breast, bladder, ovarian, pancreatic, and colon cancers. ADNP mRNA is abundantly expressed in distinct normal tissues, and high expression levels were encountered in malignant cells. ADNP is implicated in maintaining cell survival, perhaps through modulation of p53. The encoded protein contains one homeobox and nine zinc finger domains, suggesting that it functions as a transcription factor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Publications for ADNP Antibody (H00023394-M02) (0)
There are no publications for ADNP Antibody (H00023394-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ADNP Antibody (H00023394-M02) (0)
There are no reviews for ADNP Antibody (H00023394-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ADNP Antibody (H00023394-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ADNP Products
Research Areas for ADNP Antibody (H00023394-M02)
Find related products by research area.
|
Blogs on ADNP