Adenosine Deaminase/ADA Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADA. Source: E. coli
Amino Acid Sequence: QVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
ADA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90361. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Adenosine Deaminase/ADA Recombinant Protein Antigen
Background
Adenosine deaminase is an enzyme involved in purine metabolism. It is needed for the breakdown of adenosine from food and from the turnover of nucleic acids in tissues. It irreversibly deaminates adenosine, converting it to the related nucleoside inosine by the removal of an amine group. Inosine can then be deribosylated (removed from ribose) by another enzyme called purine nucleoside phosphorylase (PNP), converting it to hypoxanthine. Mutations in the gene for adenosine deaminase causing it to not be expressed are one cause of severe combined immunodeficiency (SCID). Mutations causing it to be overexpressed are one cause of hemolytic anemia. There is some evidence that a different allelle (ADA2) may lead to autism. There are 2 isoforms of ADA: ADA1 and ADA2. ADA1 is found in most body cells, particularly lymphocytes and macrophages, where it is present not only in the cytosol but also as the ecto- form on the cell membrane attached to a protein called CD26. ADA2 has only been found in the macrophage where it co-exists with ADA1 where the two isoforms regulate the ratio of adenosine to deoxyadenosine to potentiate the killing of parasites. ADA2 is the predominant form present in human plasma and is increased in many diseases, particularly those associated with the immune system: for example rheumatoid arthritis, psoriasis and sarcoidosis. The plasma AD2 isoform is also increased in most cancers.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: BA
Species: Hu
Applications: AC
Publications for Adenosine Deaminase/ADA Recombinant Protein Antigen (NBP1-90361PEP) (0)
There are no publications for Adenosine Deaminase/ADA Recombinant Protein Antigen (NBP1-90361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adenosine Deaminase/ADA Recombinant Protein Antigen (NBP1-90361PEP) (0)
There are no reviews for Adenosine Deaminase/ADA Recombinant Protein Antigen (NBP1-90361PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Adenosine Deaminase/ADA Recombinant Protein Antigen (NBP1-90361PEP) (0)
Additional Adenosine Deaminase/ADA Products
Research Areas for Adenosine Deaminase/ADA Recombinant Protein Antigen (NBP1-90361PEP)
Find related products by research area.
|
Blogs on Adenosine Deaminase/ADA