Adenosine Deaminase 2/CECR1 Antibody

Images

 
Western Blot: CECR1 Antibody [NBP1-59343] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenosine Deaminase 2/CECR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to CECR1(cat eye syndrome chromosome region, candidate 1) The peptide sequence was selected from the N terminal of CECR1. Peptide sequence MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CECR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CECR1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Adenosine Deaminase 2/CECR1 Antibody

  • ADA2
  • Adenosine Deaminase 2
  • adenosine deaminase CECR1
  • ADGF
  • ADGFadenosine deaminase 2
  • cat eye syndrome chromosome region, candidate 1
  • Cat eye syndrome critical region protein 1
  • CECR1
  • CECR2
  • EC 3.5.4.4
  • IDGFL

Background

CECR1 a member of a subfamily of the adenosine deaminase protein family. It may act as a growth factor and have adenosine deaminase activity. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene.This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein may act as a growth factor and have adenosine deaminase activity. It may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-56629
Species: Hu
Applications: WB
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-57507
Species: Hu
Applications: ICC/IF
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-45466
Species: Hu
Applications: WB, IHC
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00093624-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-59343
Species: Hu
Applications: WB

Publications for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343) (0)

There are no publications for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343) (0)

There are no reviews for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenosine Deaminase 2/CECR1 Products

Bioinformatics Tool for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343)

Discover related pathways, diseases and genes to Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343)

Discover more about diseases related to Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343).
 

Pathways for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343)

View related products by pathway.

PTMs for Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343)

Learn more about PTMs related to Adenosine Deaminase 2/CECR1 Antibody (NBP1-59343).

Blogs on Adenosine Deaminase 2/CECR1

There are no specific blogs for Adenosine Deaminase 2/CECR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenosine Deaminase 2/CECR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CECR1
Entrez
Uniprot