Adenosine Deaminase 2/CECR1 Antibody - BSA Free

Western Blot: Adenosine Deaminase 2/CECR1 Antibody [NBP1-59343] - Human Brain lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Adenosine Deaminase 2/CECR1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CECR1(cat eye syndrome chromosome region, candidate 1) The peptide sequence was selected from the N terminal of CECR1. Peptide sequence MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CECR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Adenosine Deaminase 2/CECR1 Antibody - BSA Free

• ADA2
• Adenosine Deaminase 2
• adenosine deaminase CECR1
• ADGF
• ADGFadenosine deaminase 2
• cat eye syndrome chromosome region, candidate 1
• Cat eye syndrome critical region protein 1
• CECR1
• CECR2
• EC 3.5.4.4
• IDGFL

Background

CECR1 a member of a subfamily of the adenosine deaminase protein family. It may act as a growth factor and have adenosine deaminase activity. This gene may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene.This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein may act as a growth factor and have adenosine deaminase activity. It may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CECR1
• Uniprot:
  • Q9NZK5(Human)