ADA2 beta Antibody (1C8)

Images

 
Western Blot: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of MGC21874 expression in Raw 264.7 (Cat # L024V1).
Immunohistochemistry-Paraffin: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of monoclonal antibody to MGC21874 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml
Western Blot: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of MGC21874 expression in HeLa (Cat # L013V1).
Western Blot: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of MGC21874 expression in PC-12 (Cat # L012V1).
Western Blot: ADA2 beta Antibody (1C8) [H00093624-M08] - Analysis of MGC21874 expression in NIH/3T3 (Cat # L018V1).
Sandwich ELISA: ADA2 beta Antibody (1C8) [H00093624-M08] - Detection limit for recombinant GST tagged MGC21874 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ADA2 beta Antibody (1C8) Summary

Immunogen
MGC21874 (XP_291105, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY
Specificity
MGC21874 (1C8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TADA2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Publications
Read Publication using H00093624-M08.

Reactivity Notes

Human, mouse & rat. Other species have not been tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ADA2 beta Antibody (1C8)

  • ADA2-beta
  • ADA2-like protein beta
  • MGC21874
  • transcriptional adapter 2-beta
  • transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
  • transcriptional adaptor 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-86955
Species: Hu
Applications: WB
NBP1-72426
Species: Hu
Applications: In vitro, PAGE
NBP1-89238
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-90243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47525
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
NBP2-38790
Species: Ha, Hu, Rt
Applications: IHC, IHC-P
NBP2-07996
Species: Hu
Applications: WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-58076
Species: Hu
Applications: ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NB100-2594
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-38670
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for ADA2 beta Antibody (H00093624-M08)(1)

Reviews for ADA2 beta Antibody (H00093624-M08) (0)

There are no reviews for ADA2 beta Antibody (H00093624-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADA2 beta Antibody (H00093624-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ADA2 beta Products

Bioinformatics Tool for ADA2 beta Antibody (H00093624-M08)

Discover related pathways, diseases and genes to ADA2 beta Antibody (H00093624-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ADA2 beta Antibody (H00093624-M08)

View related products by pathway.

PTMs for ADA2 beta Antibody (H00093624-M08)

Learn more about PTMs related to ADA2 beta Antibody (H00093624-M08).

Blogs on ADA2 beta

There are no specific blogs for ADA2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADA2 beta Antibody (1C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA2B
Entrez
OMIM