Recombinant Human Adenosine A2aR Protein

Product Discontinued

Recombinant Human Adenosine A2aR Protein Summary

• Description: An untagged recombinant protein corresponding to the amino acid sequence of (NP_000666.2) for Human Adenosine A2a R
  
  

  Source: Wheat Germ

  Amino Acid Sequence: MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

• Details of Functionality: This protein is not active and should not be used for experiments requiring activity.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: ADORA2A
• Purity: >20% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Functional
  • Immunoaffinity Purification
• Theoretical MW: 44.7 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Preservative: No Preservative
• Purity: >20% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenosine A2aR Protein

• A2aR
• adenosine A2 receptor
• Adenosine A2a R
• adenosine A2a receptor
• Adenosine A2aR
• adenosine receptor A2a
• adenosine receptor subtype A2a
• ADORA 2
• ADORA2
• ADORA2A
• hA2aR
• RDC8

Background

Adenosine A2a Receptor encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADORA2A