Recombinant Human Adenine Nucleotide Translocase 1 Protein

Images

 
SDS-Page: Adenine Nucleotide Translocase 1 Recombinant Protein [H00000291-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Adenine Nucleotide Translocase 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-298 of Human SLC25A4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SLC25A4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Adenine Nucleotide Translocase 1 Protein

  • AAC1
  • Adenine nucleotide translocator 1
  • ADP
  • ADP/ATP translocase 1
  • ANT 1
  • ANT1adenine nucleotide translocator 1 (skeletal muscle)
  • ATP carrier protein 1
  • ATP carrier protein, heart/skeletal muscle isoform T1
  • ATP carrier protein, heart/skeletal muscle
  • heart/skeletal muscle ATP/ADP translocator
  • PEO2
  • PEO3
  • solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4
  • Solute carrier family 25 member 4
  • T1ANT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15079
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01) (0)

There are no publications for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01) (0)

There are no reviews for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenine Nucleotide Translocase 1 Products

Bioinformatics Tool for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01)

Discover related pathways, diseases and genes to Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01)

Discover more about diseases related to Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01).
 

Pathways for Adenine Nucleotide Translocase 1 Recombinant Protein (H00000291-P01)

View related products by pathway.

Blogs on Adenine Nucleotide Translocase 1

There are no specific blogs for Adenine Nucleotide Translocase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Adenine Nucleotide Translocase 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A4