Recombinant Human ADAT3 Protein

Images

 
There are currently no images for ADAT3 Recombinant Protein (H00113179-P01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADAT3 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 351 of Human ADAT3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEPAPGLVEQPKCLEAGSPEPEPAPWQALPVLSEKQSGDVELVLAYAAPVLDKRQTSRLLKEVSALHPLPAQPHLKRVRPSRDAGSPHALEMLLCLAGPASGPRSLAELLPRPAVDPRGLGQPFLVPVPARPPLTRGQFEEARAHWPTSFHEDKQVTSALAGRLFSTQERAAMQSHMERAVWAARRAAARGLRAVGAVVVDPASDRVLATGHDCSCADNPLLHAVMVCVDLVARGQGRGTYDFRPFPACSFAPAAAPQAVRAGAVRKLDADEDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGALGTRFRIHARPDLNHRFQVFRGVLEEQCRWLDPDT

Protein/Peptide Type
Recombinant Protein
Gene
ADAT3

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAT3 Protein

  • adenosine deaminase, tRNA-specific 3, TAD3 homolog (S. cerevisiae)
  • FWP005
  • MST121
  • MSTP121
  • S863-5
  • TAD3
  • tRNA-specific adenosine deaminase 3 homolog
  • tRNA-specific adenosine deaminase-like protein 3
  • tRNA-specific adenosine-34 deaminase subunit ADAT3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84285
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57516
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-06977
Species: Mu
Applications: WB, PEP-ELISA
NBP1-91787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-32488
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88490
Species: Hu
Applications: IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADAT3 Recombinant Protein (H00113179-P01) (0)

There are no publications for ADAT3 Recombinant Protein (H00113179-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAT3 Recombinant Protein (H00113179-P01) (0)

There are no reviews for ADAT3 Recombinant Protein (H00113179-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAT3 Recombinant Protein (H00113179-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAT3 Products

Bioinformatics Tool for ADAT3 Recombinant Protein (H00113179-P01)

Discover related pathways, diseases and genes to ADAT3 Recombinant Protein (H00113179-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAT3 Recombinant Protein (H00113179-P01)

Discover more about diseases related to ADAT3 Recombinant Protein (H00113179-P01).
 

Pathways for ADAT3 Recombinant Protein (H00113179-P01)

View related products by pathway.

PTMs for ADAT3 Recombinant Protein (H00113179-P01)

Learn more about PTMs related to ADAT3 Recombinant Protein (H00113179-P01).

Blogs on ADAT3

There are no specific blogs for ADAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ADAT3 Antibody
NBP2-31732

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAT3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAT3