ADAMTS5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAMTS5 Antibody [NBP2-55654] - Staining of human cell line RH-30 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAMTS5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQ
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTS5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADAMTS5 Recombinant Protein Antigen (NBP2-55654PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAMTS5 Antibody - BSA Free

• A disintegrin and metalloproteinase with thrombospondin motifs 11
• a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 5 (aggrecanase-2)
• ADAM metallopeptidase with thrombospondin type 1 motif, 5
• ADAM-TS 11
• ADAM-TS 5
• ADAMTS11
• ADAMTS-11
• ADAMTS5
• ADAM-TS5
• ADAMTS-5
• ADMP2
• ADMP-2
• ADMP-2A disintegrin and metalloproteinase with thrombospondin motifs 5
• Aggrecanase 2
• aggrecanase-2
• disintegrin-like and metalloprotease with thrombospondin type 1 motif, 510ADAMTS11FLJ36738
• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.14
• EC 3.4.24.82

Background

ADAMTS5, also known as aggrecanase-2, is a Metallopeptidase M12B type protease that is responsible for degradation of the articular cartilage protein aggrecan. The protein contains a signal sequence, a prodomain with both a potential cysteine switch and a furin cleavage site, a metalloproteinase domain with a conserved zinc-binding motif and a 'met turn,' a disintegrin-like domain, and a spacer region between a thrombospondin type 1 motif and thrombospondin submotif. At least four transcript variants have been reported. ADAMTS5 has been implicated in inflammatory joint diseases. ADAMTS5 expression has been documented in a range of normal human tissues. ESTs have been isolated from human tissue libraries, including normal breast, embryo and heart and cancerous placenta and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTS5