Recombinant Human ADAMTS12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADAMTS12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-229 of Human ADAMTS12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW

Protein/Peptide Type
Recombinant Protein
Gene
ADAMTS12

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAMTS12 Protein

  • A disintegrin and metalloproteinase with thrombospondin motifs 12
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 12
  • ADAM metallopeptidase with thrombospondin type 1 motif, 12
  • ADAM-TS 12
  • ADAM-TS12
  • ADAMTS-12
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.82
  • PRO4389

Background

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS-1) motif. Individual members of this family differ in the number of C-terminal TS-1 motifs, and some have unique C-terminal domains. The enzyme encoded by this gene contains eight TS-1 motifs. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64779
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, IP
NBP2-38539
Species: Hu
Applications: IHC, IHC-P
AF1938
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF3626
Species: Mu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF5828
Species: Hu
Applications: WB, ICC, Neut

Publications for ADAMTS12 Recombinant Protein (H00081792-P01) (0)

There are no publications for ADAMTS12 Recombinant Protein (H00081792-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS12 Recombinant Protein (H00081792-P01) (0)

There are no reviews for ADAMTS12 Recombinant Protein (H00081792-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMTS12 Recombinant Protein (H00081792-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS12 Products

Bioinformatics Tool for ADAMTS12 Recombinant Protein (H00081792-P01)

Discover related pathways, diseases and genes to ADAMTS12 Recombinant Protein (H00081792-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS12 Recombinant Protein (H00081792-P01)

Discover more about diseases related to ADAMTS12 Recombinant Protein (H00081792-P01).
 

Pathways for ADAMTS12 Recombinant Protein (H00081792-P01)

View related products by pathway.

PTMs for ADAMTS12 Recombinant Protein (H00081792-P01)

Learn more about PTMs related to ADAMTS12 Recombinant Protein (H00081792-P01).

Blogs on ADAMTS12

There are no specific blogs for ADAMTS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAMTS12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS12