ADAMTS10 Antibody


Immunohistochemistry-Paraffin: ADAMTS10 Antibody [NBP1-89248] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ADAMTS10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK
Specificity of human ADAMTS10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADAMTS10 Protein (NBP1-89248PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADAMTS10 Antibody

  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 10
  • ADAM metallopeptidase with thrombospondin type 1 motif, 10
  • ADAM-TS 10
  • ADAMTS10
  • ADAMTS-10
  • ADAM-TS10A disintegrin and metalloproteinase with thrombospondin motifs 10
  • EC 3.4.24.-
  • EC
  • WMS
  • zinc metalloendopeptidase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IM
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADAMTS10 Antibody (NBP1-89248) (0)

There are no publications for ADAMTS10 Antibody (NBP1-89248).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS10 Antibody (NBP1-89248) (0)

There are no reviews for ADAMTS10 Antibody (NBP1-89248). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADAMTS10 Antibody (NBP1-89248) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADAMTS10 Products

Bioinformatics Tool for ADAMTS10 Antibody (NBP1-89248)

Discover related pathways, diseases and genes to ADAMTS10 Antibody (NBP1-89248). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMTS10 Antibody (NBP1-89248)

Discover more about diseases related to ADAMTS10 Antibody (NBP1-89248).

Pathways for ADAMTS10 Antibody (NBP1-89248)

View related products by pathway.

PTMs for ADAMTS10 Antibody (NBP1-89248)

Learn more about PTMs related to ADAMTS10 Antibody (NBP1-89248).

Blogs on ADAMTS10

There are no specific blogs for ADAMTS10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADAMTS10 Antibody and receive a gift card or discount.


Gene Symbol ADAMTS10