Recombinant Human ADAMDEC1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADAMDEC1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 361-470 of Human ADAMDEC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTTPVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADAMDEC1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADAMDEC1 Protein

  • A disintegrin and metalloproteinase domain-like protein decysin-1
  • ADAM DEC1
  • ADAM-like protein decysin-1
  • ADAM-like, decysin 1
  • decysin
  • disintegrin protease
  • EC 3.4.24.-
  • FLJ79219
  • M12.219

Background

ADAMDEC1 - ADAM-like, decysin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-55995
Species: Hu
Applications: ICC/IF
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
MAB935
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICC, ICFlow
930-ADB
Species: Hu
NBP1-84932
Species: Hu
Applications: IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-69364
Species: Hu
Applications: WB, ICC/IF, IHC
NB300-561
Species: Hu, Mu, Rt, Po, Bv, Eq, Ha, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB100-55403
Species: Hu
Applications: WB, PEP-ELISA
NB110-97871
Species: Mu
Applications: Flow, IHC, IHC-P, IP, CyTOF-ready
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01) (0)

There are no publications for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01) (0)

There are no reviews for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMDEC1 Products

Bioinformatics Tool for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01)

Discover related pathways, diseases and genes to ADAMDEC1 Partial Recombinant Protein (H00027299-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01)

Discover more about diseases related to ADAMDEC1 Partial Recombinant Protein (H00027299-Q01).
 

Pathways for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01)

View related products by pathway.

PTMs for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01)

Learn more about PTMs related to ADAMDEC1 Partial Recombinant Protein (H00027299-Q01).
 

Research Areas for ADAMDEC1 Partial Recombinant Protein (H00027299-Q01)

Find related products by research area.

Blogs on ADAMDEC1

There are no specific blogs for ADAMDEC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADAMDEC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMDEC1