ACTR8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ACTR8 Antibody [NBP2-57111] - Staining of human cell line SH-SY5Y shows localization to nucleus & centrosome.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YLEIPLKDLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRLCL
Specificity
Specificity of human ACTR8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ACTR8 Antibody

  • Actin-Related Protein 8
  • ARP8 (Actin-Related Protein 8, Yeast) Homolog
  • ARP8 Actin-Related Protein 8 Homolog
  • ARP8
  • HArp8
  • INO80 Complex Subunit N
  • INO80N

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78758
Species: Hu
Applications: WB (-), IP
NBP1-56569
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-19016
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-61628
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-57516
Species: Hu, Rt, Po, Bv, Eq, Rb, Ze
Applications: WB
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ChIP
NBP2-14875
Species: Hu
Applications: WB, IP
NBP2-15394
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-85260
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
NBP2-07996
Species: Hu
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, ICC/IF, IF

Publications for ACTR8 Antibody (NBP2-57111) (0)

There are no publications for ACTR8 Antibody (NBP2-57111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR8 Antibody (NBP2-57111) (0)

There are no reviews for ACTR8 Antibody (NBP2-57111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ACTR8 Antibody (NBP2-57111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACTR8 Products

Array NBP2-57111

Bioinformatics Tool for ACTR8 Antibody (NBP2-57111)

Discover related pathways, diseases and genes to ACTR8 Antibody (NBP2-57111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTR8 Antibody (NBP2-57111)

Discover more about diseases related to ACTR8 Antibody (NBP2-57111).
 

Pathways for ACTR8 Antibody (NBP2-57111)

View related products by pathway.

PTMs for ACTR8 Antibody (NBP2-57111)

Learn more about PTMs related to ACTR8 Antibody (NBP2-57111).

Blogs on ACTR8

There are no specific blogs for ACTR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR8