ACTR5 Antibody

Images

 
Immunohistochemistry: ACTR5 Antibody [NBP2-14524] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPG HLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSS KLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACTR5 Protein (NBP2-14524PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTR5 Antibody

  • ACTR5 ARP5 actin-related protein 5 homolog (yeast)
  • Arp5
  • INO80M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78758
Species: Hu
Applications: WB (-), IP
H00057180-B01P
Species: Hu
Applications: WB, ELISA
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
NBP1-57516
Species: Hu
Applications: WB
NBP1-57372
Species: Hu
Applications: WB
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-15394
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
AF2204
Species: Hu
Applications: WB, IHC
NBP2-15274
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57469
Species: Hu
Applications: WB, IHC, IHC-P
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
NBP1-46218
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA

Publications for ACTR5 Antibody (NBP2-14524) (0)

There are no publications for ACTR5 Antibody (NBP2-14524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR5 Antibody (NBP2-14524) (0)

There are no reviews for ACTR5 Antibody (NBP2-14524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACTR5 Antibody (NBP2-14524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTR5 Products

ACTR5 NBP2-14524

Bioinformatics Tool for ACTR5 Antibody (NBP2-14524)

Discover related pathways, diseases and genes to ACTR5 Antibody (NBP2-14524). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTR5 Antibody (NBP2-14524)

Discover more about diseases related to ACTR5 Antibody (NBP2-14524).

Blogs on ACTR5

There are no specific blogs for ACTR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR5
Entrez
Uniprot