ACTR5 Antibody

Images

 
Immunohistochemistry: ACTR5 Antibody [NBP2-14524] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLL
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACTR5 Protein (NBP2-14524PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTR5 Antibody

  • ACTR5 ARP5 actin-related protein 5 homolog (yeast)
  • Arp5
  • INO80M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78759
Species: Hu
Applications: IP, WB
H00057180-B01P
Species: Hu
Applications: WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-92770
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
MAB7527
Species: Mu
Applications: ICC, WB
NBP2-14306
Species: Hu
Applications: IHC, IHC-P, WB
AF2204
Species: Hu
Applications: IHC, WB
NBP2-15274
Species: Hu, Mu
Applications: IHC, IHC-P, WB
2695-SE
Species: Hu
Applications: EnzAct
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP3-16424
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88848
Species: Hu
Applications: IHC, IHC-P
AF7388
Species: Hu
Applications: IHC
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB
NBP1-84873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14524
Species: Hu, Mu, Rt
Applications: IHC

Publications for ACTR5 Antibody (NBP2-14524) (0)

There are no publications for ACTR5 Antibody (NBP2-14524).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR5 Antibody (NBP2-14524) (0)

There are no reviews for ACTR5 Antibody (NBP2-14524). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACTR5 Antibody (NBP2-14524) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTR5 Products

Array NBP2-14524

Diseases for ACTR5 Antibody (NBP2-14524)

Discover more about diseases related to ACTR5 Antibody (NBP2-14524).

Blogs on ACTR5

There are no specific blogs for ACTR5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR5
Entrez
Uniprot