ACTR1A Antibody [DyLight 650]

Product Discontinued

ACTR1A Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 187-376 of human ACTR1A (NP_005727.1).
  
  Sequence:
  GRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACTR1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for ACTR1A Antibody [DyLight 650]

• Actin-RPV
• alpha-centractin
• ARP1 (actin-related protein 1, yeast) homolog A (centractin alpha)
• ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
• ARP1actin-RPV
• centractin
• Centrosome-associated actin homolog
• CTRN1
• FLJ52695
• FLJ52800
• FLJ55002

Background

The actin-related protein ACTR1A, a member of the superfamily of actin-related proteins, is the major subunit of the dynactin complex, a key component of the cytoplasmic dynein motor machinery. The major components of the dynactin complex, consisting of at least ten polypeptides, include ACTR1A. ACTR1A, the most abundant subunit in the dynactin complex, is most similar to conventional actin (>50% amino acid identity). The dynactin complex has been shown to localize to multiple structures within the cell, including membrane organelles, the centrosome, spindle poles, and spindle pole microtubules during mitosis and prometaphase kinetochores. It regulates dyneinmediated vesicle movement on microtubules as well as spindle assembly and cell division. ACTR1A overexpression in cells results in aberrant spindle morphologies and cell cycle delay at prometaphase, suggesting a possible function of ACTR1A/dynactin complex in progression through the prometaphase of mitosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACTR1A