Activin RIIB Antibody (1C11)

Images

 
Western Blot: Activin RIIB Antibody (1C11) [H00000093-M03] - Analysis of ACVR2B expression in transfected 293T cell line by ACVR2B monoclonal antibody (M03), clone 1C11. Lane 1: ACVR2B transfected lysate (Predicted MW: ...read more
ELISA: Activin RIIB Antibody (1C11) [H00000093-M03] - Detection limit for recombinant GST tagged ACVR2B is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Activin RIIB Antibody (1C11) Summary

Immunogen
ACVR2B (NP_001097, 21 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
Specificity
ACVR2B - activin A receptor, type IIB (1C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ACVR2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Activin RIIB Antibody (1C11)

  • activin A receptor, type IIB
  • Activin receptor type IIB
  • activin receptor type-2B
  • Activin RIIB
  • ActivinRIIB
  • ACTRIIB
  • ActR-IIB
  • ACVR2B
  • EC 2.7.11
  • EC 2.7.11.30
  • MGC116908

Background

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF340
Species: Hu
Applications: WB, IHC, Block
AF1477
Species: Mu
Applications: WB, IHC, Block
NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Activin RIIB Antibody (H00000093-M03) (0)

There are no publications for Activin RIIB Antibody (H00000093-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Activin RIIB Antibody (H00000093-M03) (0)

There are no reviews for Activin RIIB Antibody (H00000093-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Activin RIIB Antibody (H00000093-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Activin RIIB Products

Bioinformatics Tool for Activin RIIB Antibody (H00000093-M03)

Discover related pathways, diseases and genes to Activin RIIB Antibody (H00000093-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Activin RIIB Antibody (H00000093-M03)

Discover more about diseases related to Activin RIIB Antibody (H00000093-M03).
 

Pathways for Activin RIIB Antibody (H00000093-M03)

View related products by pathway.

PTMs for Activin RIIB Antibody (H00000093-M03)

Learn more about PTMs related to Activin RIIB Antibody (H00000093-M03).
 

Research Areas for Activin RIIB Antibody (H00000093-M03)

Find related products by research area.

Blogs on Activin RIIB

There are no specific blogs for Activin RIIB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Activin RIIB Antibody (1C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ACVR2B
Entrez
Uniprot