Recombinant Human Activin B/Inhibin beta B Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 298-407 of Human Inhibin beta B Source: Wheat Germ Amino Acid Sequence: GRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
INHBB |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Activin B/Inhibin beta B Protein
Background
INHBB - inhibin, beta B (activin AB beta polypeptide)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for Activin B/Inhibin beta B Partial Recombinant Protein (H00003625-Q01) (0)
There are no publications for Activin B/Inhibin beta B Partial Recombinant Protein (H00003625-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Activin B/Inhibin beta B Partial Recombinant Protein (H00003625-Q01) (0)
There are no reviews for Activin B/Inhibin beta B Partial Recombinant Protein (H00003625-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Activin B/Inhibin beta B Partial Recombinant Protein (H00003625-Q01). (Showing 1 - 1 of 1 FAQ).
-
I am looking for Inhibin beta B-alpha, but active, to inhibit to cell stimulation of Activin A. The reference H00003625-Q01 says it is not active. Have you got what I am looking for? Would this inactive protein work?
- This protein H00003625-Q01 is not active due the cell free wheat germ system the protein is made in. The protein may not be post translationally modified and therefore may not fold the same as the endogenous form of the protein. This inactive protein would therefore not work for you. Unfortunately at this time we do not have any active Inhibin beta B-alpha proteins.
Additional Activin B/Inhibin beta B Products
Research Areas for Activin B/Inhibin beta B Partial Recombinant Protein (H00003625-Q01)
Find related products by research area.
|
Blogs on Activin B/Inhibin beta B