Recombinant Human Actin Alpha 1 Cardiac Muscle Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Actin Alpha 1 Cardiac Muscle Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-377 of Human ACTC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ACTC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
68.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Actin Alpha 1 Cardiac Muscle Protein

  • ACTC
  • ACTC1
  • actin, alpha, cardiac muscle 1
  • alpha-Cardiac Actin
  • ASD5
  • Cardiac alpha-Actin
  • CMD1R
  • CMH11
  • LVNC4

Background

Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9096
Species: Hu
Applications: WB, IHC
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, ChIP, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
AF7439
Species: Hu
Applications: WB, IHC
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP1-88068
Species: Hu
Applications: IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
MAB4470
Species: Multi
Applications: WB, IHC, ICC
AF3844
Species: Hu, Mu
Applications: IHC
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-36746
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
H00051086-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01) (0)

There are no publications for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01) (0)

There are no reviews for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01)

Discover related pathways, diseases and genes to Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01)

Discover more about diseases related to Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01).
 

Pathways for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01)

View related products by pathway.

PTMs for Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01)

Learn more about PTMs related to Actin Alpha 1 Cardiac Muscle Recombinant Protein (H00000070-P01).

Blogs on Actin Alpha 1 Cardiac Muscle

There are no specific blogs for Actin Alpha 1 Cardiac Muscle, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Actin Alpha 1 Cardiac Muscle Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTC1