Recombinant Human ACRC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ACRC Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 592 - 691 of Human ACRC partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACRC

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ACRC Protein

  • acidic repeat containing
  • acidic repeat-containing protein
  • NAAR1
  • putative nuclear protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
30230002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00051329-M09
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00093953-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ACRC Partial Recombinant Protein (H00093953-Q01) (0)

There are no publications for ACRC Partial Recombinant Protein (H00093953-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACRC Partial Recombinant Protein (H00093953-Q01) (0)

There are no reviews for ACRC Partial Recombinant Protein (H00093953-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACRC Partial Recombinant Protein (H00093953-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACRC Products

Bioinformatics Tool for ACRC Partial Recombinant Protein (H00093953-Q01)

Discover related pathways, diseases and genes to ACRC Partial Recombinant Protein (H00093953-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACRC Partial Recombinant Protein (H00093953-Q01)

Discover more about diseases related to ACRC Partial Recombinant Protein (H00093953-Q01).
 

Pathways for ACRC Partial Recombinant Protein (H00093953-Q01)

View related products by pathway.

PTMs for ACRC Partial Recombinant Protein (H00093953-Q01)

Learn more about PTMs related to ACRC Partial Recombinant Protein (H00093953-Q01).

Blogs on ACRC

There are no specific blogs for ACRC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ACRC Antibody
NBP1-85993

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ACRC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACRC