ACP6 Antibody

Images

 
Western Blot: ACP6 Antibody [NBP1-89272] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: ACP6 Antibody [NBP1-89272] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
49 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ACP6 Protein (NBP1-89272PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACP6 Antibody

  • acid phosphatase 6, lysophosphatidicPACPL1
  • Acid phosphatase-like protein 1
  • ACP6
  • ACPL1
  • ACPL1acid phosphatase like 1
  • EC 3.1.3.2
  • LPAP
  • LPAPlysophosphatidic acid phosphatase type 6
  • PACPL1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36565
Species: Hu
Applications: WB, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89265
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP1-89602
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004340-B01P
Species: Hu, Rt
Applications: WB
NBP2-45293
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, PAGE, IF
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56076
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-P, IP

Publications for ACP6 Antibody (NBP1-89272) (0)

There are no publications for ACP6 Antibody (NBP1-89272).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACP6 Antibody (NBP1-89272) (0)

There are no reviews for ACP6 Antibody (NBP1-89272). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACP6 Antibody (NBP1-89272) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACP6 Products

Bioinformatics Tool for ACP6 Antibody (NBP1-89272)

Discover related pathways, diseases and genes to ACP6 Antibody (NBP1-89272). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACP6 Antibody (NBP1-89272)

Discover more about diseases related to ACP6 Antibody (NBP1-89272).
 

Pathways for ACP6 Antibody (NBP1-89272)

View related products by pathway.

Research Areas for ACP6 Antibody (NBP1-89272)

Find related products by research area.

Blogs on ACP6

There are no specific blogs for ACP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACP6
Entrez
Uniprot