ACOT2 Antibody


Western Blot: ACOT2 Antibody [NBP1-70402] - Human Heart lysate, concentration 0.2-1 ug/ml.
Western Blot: ACOT2 Antibody [NBP1-70402] - Human Fetal Liver.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ACOT2 Antibody Summary

Synthetic peptides corresponding to ACOT2(acyl-CoA thioesterase 2) The peptide sequence was selected form the middle region of ACOT2 (NP_006812). Peptide sequence SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACOT2 and was validated on Western blot.
Theoretical MW
53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
From PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACOT2 Antibody

  • acyl-CoA thioesterase 2MTE1
  • Acyl-coenzyme A thioester hydrolase 2a
  • acyl-coenzyme A thioesterase 2, mitochondrial
  • CTE-Ia
  • EC
  • Long-chain acyl-CoA thioesterase 2
  • mitochondrial acyl-CoA thioesterase 1
  • mitochondrial acyl-CoA thioesterase 2
  • peroxisomal long-chain acyl-coA thioesterase 2
  • PTE2A
  • ZAP128Mte1


Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA.Acyl-CoA thioesterases, such as ACOT2, are a group of enzymes that hydrolyze CoA esters, such as acyl-CoAs, bile CoAs, and CoA esters of prostaglandins, to the corresponding free acid and CoA (Hunt et al., 2005 [PubMed 16103133]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-7 CR610624.1 1-7 8-1155 BC006335.2 1-1148 1156-1767 L40401.1 468-1079


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Pm
Applications: WB
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, ChHa, Eq, Fe, GP, Op, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACOT2 Antibody (NBP1-70402) (0)

There are no publications for ACOT2 Antibody (NBP1-70402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACOT2 Antibody (NBP1-70402) (0)

There are no reviews for ACOT2 Antibody (NBP1-70402). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACOT2 Antibody (NBP1-70402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ACOT2 Products

ACOT2 NBP1-70402

Bioinformatics Tool for ACOT2 Antibody (NBP1-70402)

Discover related pathways, diseases and genes to ACOT2 Antibody (NBP1-70402). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACOT2 Antibody (NBP1-70402)

Discover more about diseases related to ACOT2 Antibody (NBP1-70402).

Pathways for ACOT2 Antibody (NBP1-70402)

View related products by pathway.

PTMs for ACOT2 Antibody (NBP1-70402)

Learn more about PTMs related to ACOT2 Antibody (NBP1-70402).

Blogs on ACOT2

There are no specific blogs for ACOT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ACOT2 Antibody and receive a gift card or discount.


Gene Symbol ACOT2