ACCN4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ACCN4 Antibody - BSA Free (NBP2-83921) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human ACCN4. Peptide sequence: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ASIC4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ACCN4 Antibody - BSA Free
Background
ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder. FUNCTION: Probable cation channel with high affinity for sodium. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins (Probable). SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: This gene is predominantly expressed in the pituitary gland. Expressed in brain, spinal chord and dorsal root ganglion (DRG). Expressed by a subset of sensory neurons in the DRG. Expressed by granule cells in the cerebellar cortex. In hippocampus, expression is detected in dentate gyrus granule cells, in pyramidal cells of CA1-CA3 subfields and in interneurons of the striatum oriens and radiatum of all subfields. In cerebral cortex expressed in small, medium and large pyramidal cells in layers 2, 3 and 5 respectively. Also expressed in striatum, globus pallidus, inferior and superior calliculi, amygdala, magnocellular preoptic nucleus, islands of Calleja and large neurons of olfactory tubercules. DEVELOPMENTAL STAGE: Highly expressed in newborn spinal chord but hardly detected in the cerebellum compared to adult. Expressed at postnatal day 1 in ependymal cells lining the central canal of spinal chord and in motor neurons. In adult, expression decreases in ependymal cells and increases in motor neurons. The number of positive interneurons decreases but the individual interneuron expression increases in adult spinal chord compared to newborn. MISCELLANEOUS: In vitro, has no proton-gated channel activity.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu
Applications: WB
Publications for ACCN4 Antibody (NBP2-83921) (0)
There are no publications for ACCN4 Antibody (NBP2-83921).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ACCN4 Antibody (NBP2-83921) (0)
There are no reviews for ACCN4 Antibody (NBP2-83921).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ACCN4 Antibody (NBP2-83921) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ACCN4 Products
Research Areas for ACCN4 Antibody (NBP2-83921)
Find related products by research area.
|
Blogs on ACCN4