ACBD3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ACBD3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACBD3.
  
  

  Source: E.coli

  Amino Acid Sequence: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ACBD3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This peptide is useful as a blocking peptide for NBP1-83379.
  Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.
  
  For further blocking peptide related information and a protocol, click here.
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ACBD3 Recombinant Protein Antigen

• acyl-CoA binding domain containing 3
• Acyl-CoA-binding domain-containing protein 3
• acyl-Coenzyme A binding domain containing 3
• GCP60Golgi phosphoprotein 1
• GOCAP1Peripheral benzodiazepine receptor-associated protein PAP7
• golgi complex associated protein 1, 60kDa
• Golgi complex-associated protein 1
• Golgi resident protein GCP60
• GOLPH1PBR- and PKA-associated protein 7
• PAP7
• PBR associated protein
• peripherial benzodiazepine receptor associated protein
• PKA (RIalpha)-associated protein

Background

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACBD3