We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ACAT2 Recombinant Protein Antigen

Images

 
There are currently no images for ACAT2 Protein (NBP1-89526PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACAT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACAT2.

Source: E. coli

Amino Acid Sequence: LVSTRKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ACAT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89526.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACAT2 Recombinant Protein Antigen

  • acetoacetyl Coenzyme A thiolase
  • acetyl-CoA acetyltransferase 2
  • acetyl-CoA acetyltransferase, cytosolic
  • Acetyl-CoA transferase-like protein
  • acetyl-Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase)
  • acetyl-Coenzyme A acetyltransferase 2
  • ACTL
  • Cytosolic acetoacetyl-CoA thiolase
  • EC 2.3.1
  • EC 2.3.1.9

Background

The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-141
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-89284
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-74271
Species: Hu
Applications: IHC,  IHC-P
NBP1-85691
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
NBP1-62489
Species: Dr, Hu, Mu
Applications: WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP1-80712
Species: Hu
Applications: ICC/IF
NBP3-03496
Species: Hu
Applications: WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-71706
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB200-527
Species: Hu, Mu, Rt
Applications: IP, WB
NB400-128
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP3-04836
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for ACAT2 Protein (NBP1-89526PEP) (0)

There are no publications for ACAT2 Protein (NBP1-89526PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAT2 Protein (NBP1-89526PEP) (0)

There are no reviews for ACAT2 Protein (NBP1-89526PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACAT2 Protein (NBP1-89526PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACAT2 Products

Research Areas for ACAT2 Protein (NBP1-89526PEP)

Find related products by research area.

Blogs on ACAT2

There are no specific blogs for ACAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACAT2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAT2