ACAT1 Antibody

Product Discontinued

ACAT1 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ACAT1(acetyl-Coenzyme A acetyltransferase 1 (acetoacetyl Coenzyme A thiolase)) The peptide sequence was selected from the middle region of ACAT1. Peptide sequence SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYK
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (93%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACAT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against ACAT1 and was validated on Western blot.
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACAT1 Antibody

• ACAT
• ACAT1
• acetoacetyl Coenzyme A thiolase
• Acetoacetyl-CoA thiolase
• acetyl-CoA acetyltransferase 1
• acetyl-CoA acetyltransferase, mitochondrial
• acetyl-Coenzyme A acetyltransferase 1
• EC 2.3.1
• EC 2.3.1.9
• MAT
• mitochondrial acetoacetyl-CoA thiolase
• T2
• THIL

Background

ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.This gene encodes a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. This gene spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACAT1
• Uniprot:
  • P35610(Human)