ACAP4 Antibody

Images

 
Western Blot: ACAP4 Antibody [NBP2-86943] - Host: Rabbit. Target Name: ASAP3. Sample Tissue: Human Neurofibroma Tumor lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAP4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACAP4. Peptide sequence: FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLT The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ASAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAP4 Antibody

  • ARF6 GTPase-activating protein
  • arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 3 1
  • ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
  • centaurin, beta 6
  • CENTB6
  • DDEFL1
  • development and differentiation enhancing factor-like 1
  • Development and differentiation-enhancing factor-like 1
  • FLJ20199
  • Protein up-regulated in liver cancer 1
  • UPLC1ACAP4
  • up-regulated in liver cancer 1 (UPLC1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24643
Species: Mu, Rt
Applications: WB
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-52977
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NBP1-79800
Species: Hu
Applications: WB
NBP2-27177
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP, KO
NB100-866
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
H00000381-M01
Species: Hu, Mu, Rt, Ba, Ca
Applications: WB, ELISA, ICC/IF
NBP2-24608
Species: Hu, Mu, Rt, Pm
Applications: WB
NBP2-22423
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, KO
NB100-91266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00009266-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA
NBP2-34078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-91830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ACAP4 Antibody (NBP2-86943) (0)

There are no publications for ACAP4 Antibody (NBP2-86943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAP4 Antibody (NBP2-86943) (0)

There are no reviews for ACAP4 Antibody (NBP2-86943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAP4 Antibody (NBP2-86943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACAP4 Products

Bioinformatics Tool for ACAP4 Antibody (NBP2-86943)

Discover related pathways, diseases and genes to ACAP4 Antibody (NBP2-86943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAP4 Antibody (NBP2-86943)

Discover more about diseases related to ACAP4 Antibody (NBP2-86943).
 

Pathways for ACAP4 Antibody (NBP2-86943)

View related products by pathway.

PTMs for ACAP4 Antibody (NBP2-86943)

Learn more about PTMs related to ACAP4 Antibody (NBP2-86943).
 

Research Areas for ACAP4 Antibody (NBP2-86943)

Find related products by research area.

Blogs on ACAP4

There are no specific blogs for ACAP4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAP4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASAP3