ACADVL Antibody

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml

Immunohistochemistry-Paraffin: ACADVL Antibody [NBP1-54378] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1:100

Western Blot: ACADVL Antibody [NBP1-54378] - Lanes: 1 : Normal controls Normal enzyme expression 2: Normal controls Normal enzyme expression 3: Positive mutants Defective enzyme expression 4: Positive mutants Defective enzyme expression 5: Positive mutants Defective enzyme expression Primary Antibody Dilution: 1 : 2000 Secondary Antibody: Secondary Antibody Dilution: 1 : 1000 Gene name: ACADVL Submitted by: David Lombert, Medical College of Wisconsin.

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ACADVL is supported by BioGPS gene expression data to be expressed in HeLa

Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml

Western Blot: ACADVL Antibody [NBP1-54378] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate ACADVL is supported by BioGPS gene expression data to be expressed in HepG2

Product Discontinued

ACADVL Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ACADVL(acyl-Coenzyme A dehydrogenase, very long chain) The peptide sequence was selected from the N terminal of ACADVL (NP_001029031). Peptide sequence RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACADVL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 64 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ACADVL Antibody

• ACAD6
• acyl-CoA dehydrogenase, very long chain
• acyl-Coenzyme A dehydrogenase, very long chain
• EC 1.3.99
• EC 1.3.99.-
• LCACD
• very long-chain specific acyl-CoA dehydrogenase, mitochondrial
• VLCAD

Background

ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACADVL
• Entrez:
  • 37(Human)
• Uniprot:
  • P49748(Human)