ACADVL Antibody

Images

 
Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Adult Placenta Antibody Dilution: 1.0 ug/ml
Immunocytochemistry/ Immunofluorescence: ACADVL Antibody [NBP1-54378] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody ...read more
Western Blot: ACADVL Antibody [NBP1-54378] - Lanes: 1 : Normal controls Normal enzyme expression 2: Normal controls Normal enzyme expression 3: Positive mutants Defective enzyme expression 4: Positive mutants Defective ...read more
Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml ACADVL is supported by BioGPS gene expression data to be expressed in HeLa
Western Blot: ACADVL Antibody [NBP1-54378] - Sample Type: Human Fetal Muscle Antibody Dilution: 1.0 ug/ml
Western Blot: ACADVL Antibody [NBP1-54378] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: HepG2 cell lysate ACADVL is supported by BioGPS gene expression data to be expressed in HepG2

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACADVL Antibody Summary

Immunogen
Synthetic peptides corresponding to ACADVL(acyl-Coenzyme A dehydrogenase, very long chain) The peptide sequence was selected from the N terminal of ACADVL (NP_001029031). Peptide sequence RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACADVL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against ACADVL and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
ACADVL Lysate (NBP2-65799)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACADVL Antibody

  • ACAD6
  • acyl-CoA dehydrogenase, very long chain
  • acyl-Coenzyme A dehydrogenase, very long chain
  • EC 1.3.99
  • EC 1.3.99.-
  • LCACD
  • very long-chain specific acyl-CoA dehydrogenase, mitochondrial
  • VLCAD

Background

ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89290
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89289
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-83387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NB100-53791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF3998
Species: Hu
Applications: WB
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-62489
Species: Hu
Applications: WB
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for ACADVL Antibody (NBP1-54378) (0)

There are no publications for ACADVL Antibody (NBP1-54378).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACADVL Antibody (NBP1-54378) (0)

There are no reviews for ACADVL Antibody (NBP1-54378). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ACADVL Antibody (NBP1-54378) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACADVL Antibody (NBP1-54378)

Discover related pathways, diseases and genes to ACADVL Antibody (NBP1-54378). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACADVL Antibody (NBP1-54378)

Discover more about diseases related to ACADVL Antibody (NBP1-54378).
 

Pathways for ACADVL Antibody (NBP1-54378)

View related products by pathway.

PTMs for ACADVL Antibody (NBP1-54378)

Learn more about PTMs related to ACADVL Antibody (NBP1-54378).

Blogs on ACADVL

There are no specific blogs for ACADVL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACADVL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACADVL
Entrez
Uniprot