ABHD14B Antibody - BSA Free

Western Blot: ABHD14B Antibody [NBP1-84472] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunocytochemistry/Immunofluorescence: ABHD14B Antibody [NBP1-84472] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.

Immunohistochemistry-Paraffin: ABHD14B Antibody [NBP1-84472] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells and islet cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABHD14B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABHD14B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ABHD14B Protein (NBP1-84472PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ABHD14B Antibody - BSA Free

• abhydrolase domain containing 14B
• abhydrolase domain-containing protein 14B
• CCG1-interacting factor B
• CIBcell cycle gene 1-interacting factor B
• EC 3.-
• EC 3.1.11.6
• EC 3.1.21.4
• MGC15429

Background

ABHD14B has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABHD14B
• Entrez:
  • 84836(Human)
• Uniprot:
  • Q96IU4(Human)