ABCB9 Antibody


Western Blot: ABCB9 Antibody [NBP1-69513] - This Anti-ABCB9 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ABCB9 Antibody Summary

Synthetic peptides corresponding to ABCB9(ATP-binding cassette, sub-family B (MDR/TAP), member 9) The peptide sequence was selected from the N terminal of ABCB9. Peptide sequence RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ABCB9 and was validated on Western blot.
Theoretical MW
80 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ABCB9 Antibody

  • ABC transporter 9 protein
  • ATP-binding cassette sub-family B member 9
  • ATP-binding cassette transporter 9
  • ATP-binding cassette, sub-family B (MDR/TAP), member 9
  • EC 3.6.3
  • EC
  • EST122234
  • hABCB9
  • KIAA1520
  • TAPL
  • TAP-like protein


ABCB9, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABCB9 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes. Alternative splicing of this gene results in distinct isoforms which are likely to have different substrate specifications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCB9 Antibody (NBP1-69513) (0)

There are no publications for ABCB9 Antibody (NBP1-69513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCB9 Antibody (NBP1-69513) (0)

There are no reviews for ABCB9 Antibody (NBP1-69513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABCB9 Antibody (NBP1-69513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ABCB9 Products

Bioinformatics Tool for ABCB9 Antibody (NBP1-69513)

Discover related pathways, diseases and genes to ABCB9 Antibody (NBP1-69513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCB9 Antibody (NBP1-69513)

Discover more about diseases related to ABCB9 Antibody (NBP1-69513).

Pathways for ABCB9 Antibody (NBP1-69513)

View related products by pathway.

PTMs for ABCB9 Antibody (NBP1-69513)

Learn more about PTMs related to ABCB9 Antibody (NBP1-69513).

Research Areas for ABCB9 Antibody (NBP1-69513)

Find related products by research area.

Blogs on ABCB9

There are no specific blogs for ABCB9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ABCB9 Antibody and receive a gift card or discount.


Gene Symbol ABCB9