ABCA5 Recombinant Protein Antigen

Images

 
There are currently no images for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ABCA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCA5.

Source: E. coli

Amino Acid Sequence: DQQLVYSLPFKDMDKFSGLFSALDSHSNLGVISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKASLVSTMS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68798.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCA5 Recombinant Protein Antigen

  • ABC13
  • ATP-binding cassette A5
  • ATP-binding cassette sub-family A member 5
  • ATP-binding cassette, sub-family A (ABC1), member 5
  • DKFZp451F117
  • DKFZp779N2435
  • EC 3.6.3
  • EC 3.6.3.25
  • EC 3.6.3.41
  • EST90625
  • FLJ16381
  • KIAA1888

Background

ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. ABCA5 is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of ABCA5 results in several transcript variants; however, not all variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-92497
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-20863
Species: Hu
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-93469
Species: Hu
Applications: Flow, IHC, IHC-P, PEP-ELISA
NBP1-91641
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-163
Species: Mu
Applications: Flow, IHC, IHC-P, WB
NBP3-16029
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP1-77687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, IP, In vitro, In vivo, Simple Western, WB
NBP1-69023
Species: Mu
Applications: WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-68798PEP
Species: Hu
Applications: AC

Publications for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP) (0)

There are no publications for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP) (0)

There are no reviews for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCA5 Products

Array NBP2-68798PEP

Research Areas for ABCA5 Recombinant Protein Antigen (NBP2-68798PEP)

Find related products by research area.

Blogs on ABCA5

There are no specific blogs for ABCA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCA5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA5