AASS Antibody

Images

 
Independent Antibodies: Western Blot: AASS Antibody [NBP1-82832] - Analysis using Anti-AASS antibody NBP1-82832 (A) shows similar pattern to independent antibody NBP1-82833 (B).
Immunocytochemistry/ Immunofluorescence: AASS Antibody [NBP1-82832] - Staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining in human liver and skeletal muscle tissues using NBP1-82832 antibody. Corresponding AASS RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human endometrium, kidney, liver and skeletal muscle using Anti-AASS antibody NBP1-82832 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82832] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

AASS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYK
Specificity
Specificity of human AASS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AASS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AASS Protein (NBP1-82832PEP)
Publications
Read Publication using NBP1-82832.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 23570448)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AASS Antibody

  • aminoadipate-semialdehyde synthase
  • aminoadipic semialdehyde synthase
  • LKR/SDH
  • LKRSDH
  • LORSDH
  • lysine-2-oxoglutarate reductase
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP2-74045
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89322
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02117
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP3-04541
Species: Hu, Mu
Applications: WB, IHC
NB100-344
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67727
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AASS Antibody (NBP1-82832)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-82832 Applications Species
Houten SM, te Brinke H, Denis S et al. Genetic basis of hyperlysinemia. Orphanet J Rare Dis 2013 Apr 9 [PMID: 23570448]

Reviews for AASS Antibody (NBP1-82832) (0)

There are no reviews for AASS Antibody (NBP1-82832). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AASS Antibody (NBP1-82832) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AASS Products

Array NBP1-82832

Bioinformatics Tool for AASS Antibody (NBP1-82832)

Discover related pathways, diseases and genes to AASS Antibody (NBP1-82832). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AASS Antibody (NBP1-82832)

Discover more about diseases related to AASS Antibody (NBP1-82832).
 

Pathways for AASS Antibody (NBP1-82832)

View related products by pathway.

PTMs for AASS Antibody (NBP1-82832)

Learn more about PTMs related to AASS Antibody (NBP1-82832).

Blogs on AASS

There are no specific blogs for AASS, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AASS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AASS