AASS Antibody

Images

 
Western Blot: AASS Antibody [NBP1-82831] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: AASS Antibody [NBP1-82831] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria & vesicles.
Immunohistochemistry-Paraffin: AASS Antibody [NBP1-82831] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: AASS Antibody [NBP1-82831] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AASS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEEKLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AASS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
102 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
AASS Protein (NBP1-82831PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AASS Antibody

  • aminoadipate-semialdehyde synthase
  • aminoadipic semialdehyde synthase
  • LKR/SDH
  • LKRSDH
  • LORSDH
  • lysine-2-oxoglutarate reductase
  • mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-89322
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02117
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-49445
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-344
Species: Hu
Applications: WB, IHC, IHC-P
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82831
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AASS Antibody (NBP1-82831) (0)

There are no publications for AASS Antibody (NBP1-82831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AASS Antibody (NBP1-82831) (0)

There are no reviews for AASS Antibody (NBP1-82831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for AASS Antibody (NBP1-82831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AASS Products

AASS NBP1-82831

Bioinformatics Tool for AASS Antibody (NBP1-82831)

Discover related pathways, diseases and genes to AASS Antibody (NBP1-82831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AASS Antibody (NBP1-82831)

Discover more about diseases related to AASS Antibody (NBP1-82831).
 

Pathways for AASS Antibody (NBP1-82831)

View related products by pathway.

PTMs for AASS Antibody (NBP1-82831)

Learn more about PTMs related to AASS Antibody (NBP1-82831).

Blogs on AASS

There are no specific blogs for AASS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AASS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AASS
Entrez
Uniprot