AAK1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining in human parathyroid gland and pancreas tissues using anti-AAK1 antibody. Corresponding AAK1 RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human colon, liver, lymph node and parathyroid gland using Anti-AAK1 antibody NBP1-84110 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: AAK1 Antibody [NBP1-84110] - Staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human colon.
Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human liver.
Immunohistochemistry-Paraffin: AAK1 Antibody [NBP1-84110] - Staining of human lymph node.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AAK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIGKVIISVSSVMHDMCA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AAK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AAK1 Protein (NBP1-84110PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AAK1 Antibody

  • AAK1
  • Adaptor-associated kinase 1
  • AP2 associated kinase 1
  • AP2-associated protein kinase 1
  • DKFZp686F03202
  • DKFZp686K16132
  • EC 2.7.11.1
  • FLJ23712
  • FLJ25931
  • FLJ31060
  • FLJ45252
  • KIAA1048FLJ42882
  • MGC138170
  • MGC164568
  • MGC164570

Background

AAK1 (AP2-associated kinase 1) is a Ser/Thr protein kinase. The rat homolog was first identified in a screen of a rat brain cDNA library using a domain of the alpha subunit of the heterotetrameric AP2 complex as bait. The AP2 complex is one of two major coat proteins of endocytic vesicles that function in receptor-mediated endocytosis and the recycling of synaptic vesicles. AAK1 is responsible for phosphorylating the mu subunit of AP2 to promote clathrin-mediated endocytosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AAK1 Antibody (NBP1-84110) (0)

There are no publications for AAK1 Antibody (NBP1-84110).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AAK1 Antibody (NBP1-84110) (0)

There are no reviews for AAK1 Antibody (NBP1-84110). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AAK1 Antibody (NBP1-84110) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AAK1 Products

Research Areas for AAK1 Antibody (NBP1-84110)

Find related products by research area.

Blogs on AAK1

There are no specific blogs for AAK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AAK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AAK1
Entrez
Uniprot