A-RAF Antibody (3E2.)

Images

 
Western Blot: A-RAF Antibody (3E2) [H00000369-M05] - Analysis of ARAF expression in HeLa (Cat # L013V1).
Western Blot: A-RAF Antibody (3E2) [H00000369-M05] - Analysis of ARAF expression in transfected 293T cell line by ARAF monoclonal antibody (M05), clone 3E2. Lane 1: ARAF transfected lysatE (67.6 KDa). Lane 2: ...read more
ELISA: A-RAF Antibody (3E2) [H00000369-M05] - Detection limit for recombinant GST tagged ARAF is approximately 0.1ng/ml as a capture antibody.
Proximity Ligation Assay: A-RAF Antibody (3E2) [H00000369-M05] - Analysis of protein-protein interactions between PKM2 and ARAF. HeLa cells were stained with anti-PKM2 rabbit purified polyclonal 1:1200 and anti-ARAF ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
3E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

A-RAF Antibody (3E2.) Summary

Immunogen
ARAF (NP_001645, 151 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGS
Specificity
ARAF - v-raf murine sarcoma 3611 viral oncogene homolog
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARAF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for A-RAF Antibody (3E2.)

  • ARaf
  • A-Raf
  • ARAF1A-RAF
  • EC 2.7.11
  • EC 2.7.11.1
  • Oncogene ARAF1
  • PKS
  • PKS2
  • PKS2A-Raf proto-oncogene serine/threonine-protein kinase
  • Proto-oncogene A-Raf
  • Proto-oncogene A-Raf-1
  • Proto-oncogene Pks
  • RAFA1
  • Ras-binding protein DA-Raf
  • serine/threonine-protein kinase A-Raf
  • v-raf murine sarcoma 3611 viral oncogene homolog 1
  • v-raf murine sarcoma 3611 viral oncogene homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43792
Species: Hu
Applications: WB
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP2-56533
Species: Hu
Applications: ICC/IF

Publications for A-RAF Antibody (H00000369-M05) (0)

There are no publications for A-RAF Antibody (H00000369-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for A-RAF Antibody (H00000369-M05) (0)

There are no reviews for A-RAF Antibody (H00000369-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for A-RAF Antibody (H00000369-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional A-RAF Products

Bioinformatics Tool for A-RAF Antibody (H00000369-M05)

Discover related pathways, diseases and genes to A-RAF Antibody (H00000369-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for A-RAF Antibody (H00000369-M05)

Discover more about diseases related to A-RAF Antibody (H00000369-M05).
 

Pathways for A-RAF Antibody (H00000369-M05)

View related products by pathway.

PTMs for A-RAF Antibody (H00000369-M05)

Learn more about PTMs related to A-RAF Antibody (H00000369-M05).
 

Research Areas for A-RAF Antibody (H00000369-M05)

Find related products by research area.

Blogs on A-RAF

There are no specific blogs for A-RAF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our A-RAF Antibody (3E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARAF
Entrez
OMIM
Uniprot