Recombinant Human 60S ribosomal protein L23 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human 60S ribosomal protein L23 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 41-140 of Human RPL23 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RPL23
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human 60S ribosomal protein L23 Protein

  • MGC111167
  • MGC117346
  • MGC72008,60S ribosomal protein L17,60S ribosomal protein L23
  • ribosomal protein L17
  • ribosomal protein L23
  • rpL17

Background

RPL23 - ribosomal protein L23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-06069
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49581
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33622
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006223-M01
Species: Hu
Applications: WB, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01) (0)

There are no publications for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01) (0)

There are no reviews for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional 60S ribosomal protein L23 Products

Bioinformatics Tool for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01)

Discover related pathways, diseases and genes to 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01)

Discover more about diseases related to 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01).
 

Pathways for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01)

View related products by pathway.

PTMs for 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01)

Learn more about PTMs related to 60S ribosomal protein L23 Partial Recombinant Protein (H00009349-Q01).

Blogs on 60S ribosomal protein L23

There are no specific blogs for 60S ribosomal protein L23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human 60S ribosomal protein L23 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL23