60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

Western Blot: 60S ribosomal protein L23 Antibody (2F12) [H00009349-M01] - Detection against Immunogen (34.21 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free (H00009349-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: RPL23 (AAH34378, 1 a.a. ~ 77 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSKRGRGGSSGAKFRISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKGE
• Specificity: RPL23 - ribosomal protein L23 (2F12)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: RPL23
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for 60S ribosomal protein L23 Antibody (2F12) - Azide and BSA Free

• MGC111167
• MGC117346
• MGC72008,60S ribosomal protein L17,60S ribosomal protein L23
• ribosomal protein L17
• ribosomal protein L23
• rpL17

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14P family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as rpL17 because the encoded protein shares amino acid identity with ribosomal protein L17 from Saccharomyces cerevisiae; however, its official symbol is RPL23. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RPL23
• Entrez:
  • 9349(Human)