58K Golgi Protein Antibody

Images

 
Independent Antibodies: Western Blot: 58K Golgi Protein Antibody [NBP2-48600] - Analysis using Anti-FTCD antibody NBP2-48600 (A) shows similar pattern to independent antibody NBP2-48601 (B).
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining in human liver and pancreas tissues using anti-FTCD antibody. Corresponding FTCD RNA-seq data are presented ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining of human cerebral cortex, colon, kidney and liver using Anti-FTCD antibody NBP2-48600 (A) shows similar ...read more
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining of human kidney.
Immunohistochemistry-Paraffin: 58K Golgi Protein Antibody [NBP2-48600] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

58K Golgi Protein Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLD
Specificity
Specificity of human 58K Golgi Protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FTCD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 58K Golgi Protein Antibody

  • formimidoyltransferase cyclodeaminase
  • formimidoyltransferase-cyclodeaminase
  • formiminotransferase cyclodeaminase
  • Formiminotransferase-cyclodeaminase
  • human formiminotransferase cyclodeaminase, EC 4.3.1.410formiminotransferase-cyclodeaminase
  • LCHC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75515
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67020
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-48817
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-57749
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC
NBP2-48600
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for 58K Golgi Protein Antibody (NBP2-48600) (0)

There are no publications for 58K Golgi Protein Antibody (NBP2-48600).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 58K Golgi Protein Antibody (NBP2-48600) (0)

There are no reviews for 58K Golgi Protein Antibody (NBP2-48600). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 58K Golgi Protein Antibody (NBP2-48600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional 58K Golgi Protein Products

Bioinformatics Tool for 58K Golgi Protein Antibody (NBP2-48600)

Discover related pathways, diseases and genes to 58K Golgi Protein Antibody (NBP2-48600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 58K Golgi Protein Antibody (NBP2-48600)

Discover more about diseases related to 58K Golgi Protein Antibody (NBP2-48600).
 

Pathways for 58K Golgi Protein Antibody (NBP2-48600)

View related products by pathway.

PTMs for 58K Golgi Protein Antibody (NBP2-48600)

Learn more about PTMs related to 58K Golgi Protein Antibody (NBP2-48600).
 

Research Areas for 58K Golgi Protein Antibody (NBP2-48600)

Find related products by research area.

Blogs on 58K Golgi Protein

There are no specific blogs for 58K Golgi Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 58K Golgi Protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FTCD