5-HT3B Antibody


Immunohistochemistry: 5-HT3B Antibody [NBP1-90316] - Staining of human pancreas shows moderate cytoplasmic and nucleolar positivity in exocrine pancreas.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

5-HT3B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSR
Specificity of human 5-HT3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
5-HT3B Protein (NBP1-90316PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for 5-HT3B Antibody

  • 5HT3B
  • 5-HT3B
  • 5-HT3-B
  • 5-HT3B5-hydroxytryptamine receptor 3B
  • 5-hydroxytryptamine (serotonin) receptor 3B
  • 5-hydroxytryptamine 3 receptor B subunit
  • HTR3B
  • Serotonin receptor 3B
  • serotonin-gated ion channel subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for 5-HT3B Antibody (NBP1-90316) (0)

There are no publications for 5-HT3B Antibody (NBP1-90316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT3B Antibody (NBP1-90316) (0)

There are no reviews for 5-HT3B Antibody (NBP1-90316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5-HT3B Antibody (NBP1-90316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional 5-HT3B Products

Bioinformatics Tool for 5-HT3B Antibody (NBP1-90316)

Discover related pathways, diseases and genes to 5-HT3B Antibody (NBP1-90316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT3B Antibody (NBP1-90316)

Discover more about diseases related to 5-HT3B Antibody (NBP1-90316).

Pathways for 5-HT3B Antibody (NBP1-90316)

View related products by pathway.

Blogs on 5-HT3B

There are no specific blogs for 5-HT3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our 5-HT3B Antibody and receive a gift card or discount.


Gene Symbol HTR3B