5-HT3B Antibody

Images

 
Immunohistochemistry: 5-HT3B Antibody [NBP1-90316] - Staining of human pancreas shows moderate cytoplasmic and nucleolar positivity in exocrine pancreas.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT3B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR3B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
5-HT3B Protein (NBP1-90316PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT3B Antibody

  • 5HT3B
  • 5-HT3B
  • 5-HT3-B
  • 5-HT3B5-hydroxytryptamine receptor 3B
  • 5-hydroxytryptamine (serotonin) receptor 3B
  • 5-hydroxytryptamine 3 receptor B subunit
  • HTR3B
  • Serotonin receptor 3B
  • serotonin-gated ion channel subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56351
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46466
Species: Hu
Applications: IHC
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
640-A3
Species: Mu
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB38951
Species: Hu
Applications: IHC
NB100-1618
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90316
Species: Hu
Applications: IHC, IHC-P

Publications for 5-HT3B Antibody (NBP1-90316) (0)

There are no publications for 5-HT3B Antibody (NBP1-90316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT3B Antibody (NBP1-90316) (0)

There are no reviews for 5-HT3B Antibody (NBP1-90316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5-HT3B Antibody (NBP1-90316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5-HT3B Products

Bioinformatics Tool for 5-HT3B Antibody (NBP1-90316)

Discover related pathways, diseases and genes to 5-HT3B Antibody (NBP1-90316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT3B Antibody (NBP1-90316)

Discover more about diseases related to 5-HT3B Antibody (NBP1-90316).
 

Pathways for 5-HT3B Antibody (NBP1-90316)

View related products by pathway.

Blogs on 5-HT3B

There are no specific blogs for 5-HT3B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT3B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR3B
Entrez