5-HT3E Antibody

Images

 
Western Blot: 5-HT3E Antibody [NBP2-82540] - WB Suggested Anti-HTR3E Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human heart
Immunohistochemistry: 5-HT3E Antibody [NBP2-82540] - Immunofluorescence -- Dilution: 1.3ug/mL

Product Details

Summary
Reactivity Hu, Mu, CaSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT3E Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human 5-HT3E. Peptide sequence: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Canine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
HTR3E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT3E Antibody

  • 5-HT3 receptor subunit E splice variant HTR3Ea
  • 5-HT3c1
  • 5-HT3c1,5-HT3E
  • 5HT3E
  • 5-HT3E
  • 5-hydroxytryptamine (serotonin) receptor 3, family member E
  • 5-hydroxytryptamine receptor 3E
  • HTR3E
  • MGC120035
  • MGC120036
  • serotonin receptor 3E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56351
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-61787
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-33583
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-119
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Ch, Eq, Pm, Xp, Ze
Applications: WB, Simple Western, IHC, IHC-P
NB100-74555
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-13923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-795
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-67667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22452
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for 5-HT3E Antibody (NBP2-82540) (0)

There are no publications for 5-HT3E Antibody (NBP2-82540).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT3E Antibody (NBP2-82540) (0)

There are no reviews for 5-HT3E Antibody (NBP2-82540). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5-HT3E Antibody (NBP2-82540) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional 5-HT3E Products

Bioinformatics Tool for 5-HT3E Antibody (NBP2-82540)

Discover related pathways, diseases and genes to 5-HT3E Antibody (NBP2-82540). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT3E Antibody (NBP2-82540)

Discover more about diseases related to 5-HT3E Antibody (NBP2-82540).
 

Pathways for 5-HT3E Antibody (NBP2-82540)

View related products by pathway.

Blogs on 5-HT3E

There are no specific blogs for 5-HT3E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT3E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR3E