5-HT2A Antibody

Images

 
Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human lateral ventricle shows distinct positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5-HT2A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HTR2A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
5-HT2A Protein (NBP1-90318PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5-HT2A Antibody

  • 5-HT2 receptor
  • 5-HT-2
  • 5HT2A
  • 5-HT2A
  • 5-HT-2A
  • 5-hydroxytryptamine (serotonin) receptor 2A
  • 5-hydroxytryptamine receptor 2A
  • HTR2,5-HT2A
  • HTR2A
  • serotonin 5-HT-2A receptor
  • Serotonin receptor 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-55429
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-78403
Species: Hu
Applications: WB, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56352
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-46557
Species: Mu, Rt
Applications: WB, IHC

Publications for 5-HT2A Antibody (NBP1-90318) (0)

There are no publications for 5-HT2A Antibody (NBP1-90318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5-HT2A Antibody (NBP1-90318) (0)

There are no reviews for 5-HT2A Antibody (NBP1-90318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for 5-HT2A Antibody (NBP1-90318) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5-HT2A Products

Bioinformatics Tool for 5-HT2A Antibody (NBP1-90318)

Discover related pathways, diseases and genes to 5-HT2A Antibody (NBP1-90318). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5-HT2A Antibody (NBP1-90318)

Discover more about diseases related to 5-HT2A Antibody (NBP1-90318).
 

Pathways for 5-HT2A Antibody (NBP1-90318)

View related products by pathway.

PTMs for 5-HT2A Antibody (NBP1-90318)

Learn more about PTMs related to 5-HT2A Antibody (NBP1-90318).
 

Research Areas for 5-HT2A Antibody (NBP1-90318)

Find related products by research area.

Blogs on 5-HT2A

There are no specific blogs for 5-HT2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5-HT2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HTR2A
Entrez
Uniprot