5-HT2A Antibody

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Analysis in human cerebral cortex and liver tissues. Corresponding 5-HT2A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human colon shows strong cytoplasmic positivity in peripheral ganglion.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human caudate putamen shows moderate membranous positivity in glial cells.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human cerebral cortex shows weak positivity in plasma membrane in glial cells.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human liver shows no membranous positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human testis shows low membranous positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human small intestine shows very weak membranous positivity in glanular cells as expected.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Analysis in human cerebral cortex and liver tissues using NBP1-90318 antibody. Corresponding HTR2A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human caudate nucleus shows moderate cytoplasmic positivity in neuronal cell bodies and processes.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: 5-HT2A Antibody [NBP1-90318] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Discontinued

5-HT2A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQ
• Predicted Species: Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HTR2A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID:32355561).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for 5-HT2A Antibody

• 5-HT2 receptor
• 5-HT-2
• 5HT2A
• 5-HT2A
• 5-HT-2A
• 5-hydroxytryptamine (serotonin) receptor 2A
• 5-hydroxytryptamine receptor 2A
• HTR2,5-HT2A
• HTR2A
• serotonin 5-HT-2A receptor
• Serotonin receptor 2A

Background

The 5HT2A Receptor gene encodes one of the receptors for serotonin, a neurotransmitter with many roles. Mutations in this gene areassociated with susceptibility to schizophrenia and obsessive-compulsive disorder, and are also associated withresponse to the antidepressant citalopram in patients with major depressive disorder (MDD). MDD patients who also havea mutation in intron 2 of this gene show a significantly reduced response to citalopram as this antidepressantdownregulates expression of this gene. Multiple transcript variants encoding different isoforms have been found forthis gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 5-HT2A Antibody (NBP1-90318)(1)

Publication using NBP1-90318

• Marsh-Wakefield F, Ashhurst T, Trend S et al. IgG3+ B cells are associated with the development of multiple sclerosis Clin Transl Immunology 2020-05-01 [PMID: 32355561] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: HTR2A
• Entrez:
  • 3356(Human)
• Uniprot:
  • P28223(Human)